Sale!

Homework 2: Cryptanalysis

$30.00

Category:
Rate this product

Intro to Computer Security Homework 2: Cryptanalysis

Solve both of the following problems. You will probably want to write some short programs to help;
submit them along with your answers. This might be a good opportunity to try Python, but you may
use any common language or numerical package.
1. Here is some ciphertext that was produced with a Vigenère cipher:
GERGHDEVNIYMXQXUXGFPAXVVVOCBWGNUMDDXRVYBXOYRLWCGQIPNISRMQZNEWRYXVHEWCR
LRIISHCRPXFTIFMEWGOGRMRLTOAJIQTUJTPWNKZSHKSEXXSCCVNECMXRMFTSCJRGBGJHGS
GGBEUPLHNGRZNXMAZGFDRSPHCGIFEGHMSGASZXKVTGRSELSCAIBYRRKCVFTIWTQEAWNVXA
LNKVFTJEGXUHDTEEBFIHYWCXTHHGRVGWCGKEGBFBHCGHKZHNQYPARGSYXNVFBUGHRGKWPJ
MGRUOIYMAMVUGGXLTLHWCRGBTOIGSATERCMREXGISGEGBFBBMHRKEQGWTGHXFPNLLBEHTP
WRVKGIFIQBJQXNPVGVGDDQNMYSBYXVVJQDKTHMVFHAMRGTSPLHREVQIPMPTCSCEMAXVFXL
KZHUSGLGERGHDEVNIYMXQLRTMWAWFNLVRDLQNMYSBYXVVRZIFIBKPOCBGBFGIICVFVZSCA
ICKRQIGGRVIMERSTKRDWGGNEXCGGXUFJOGCHRLZUCCHNKFICBGBFGIIYXVHEOAFEEWESHQ
EFLLAERMBGJAPIMAZJIRFEYZFFXRLZLYOGBXBUISPIMAIIORRMPXSMPLCNWMSGQEERZHXQ
XUXFFTRMPTCZNNSFLZPACXBUISPIWHVYOHWWGXDPJRMGBJWCDINLZPACXBWFGDZCNGPYCM
AAIIORRMPTCATYRFVIMERSYHXMGCPNMVRICGUGFZDECUTJFPGWRWRBJKFRKFTACKNEZGHS
IFMYSTJIPMICCGGSKFBIGIEYFICBEGBFBLYWVGMCATIQBEORYWRBEHWCYABKSSQXNMVGLF
MPAHITQXVHESSULRMYSGPIDNZFXLKFNJDTAXRWTFXKMATCGIMTEHMWSCXUXZFSCGERGHXM
RXXPGIMPNPVBUMVPXDSCRMFNEQDLWGBKIIGSATCHWCISYRFVSIQMYOIRLVLZGPTMBERHXM
RBYKVTPMTAKCULSGUVWCEJBKTSSRSVGTFXKMATKSDLIFXCTPQKVOVBXLXUXWWURLNFVBSK
Assume that encrypting with the key letter A results in no change, B results in an increment by
one place in the alphabet, C results in an increment by two places, etc.
What is the key? (Please show your work.)
2. Here is a table of the relative frequency of letters in English text:
A: 8.167% B: 1.492% C: 2.782% D: 4.253% E: 12.702% F: 2.228% G: 2.015%
H: 6.094% I: 6.996% J: 0.153% K: 0.772% L: 4.025% M: 2.406% N: 6.749%
O: 7.507% P: 1.929% Q: 0.095% R: 5.987% S: 6.327% T: 9.056% U: 2.758%
V: 0.978% W: 2.360% X: 0.150% Y: 1.974% Z: 0.074%
Here is some plaintext:
ethicslawanduniversitypoliciestodefendasystemyouneedtobeabletothinklik
eanattackerandthatincludesunderstandingtechniquesthatcanbeusedtocompro
misesecurityhoweverusingthosetechniquesintherealworldmayviolatethelawo
rtheuniversitysrulesanditmaybeunethicalundersomecircumstancesevenprobi
ngforweaknessesmayresultinseverepenaltiesuptoandincludingexpulsioncivi
lfinesandjailtimeourpolicyineecsisthatyoumustrespecttheprivacyandprope
rtyrightsofothersatalltimesorelseyouwillfailthecourseactinglawfullyand
ethicallyisyourresponsibilitycarefullyreadthecomputerfraudandabuseactc
faaafederalstatutethatbroadlycriminalizescomputerintrusionthisisoneofs
everallawsthatgovernhackingunderstandwhatthelawprohibitsyoudontwanttoe
nduplikethisguyifindoubtwecanreferyoutoanattorneypleasereviewitsspolic
iesonresponsibleuseoftechnologyresourcesandcaenspolicydocumentsforguid
elinesconcerningproperuseofinformationtechnologyatumaswellastheenginee
ringhonorcodeasmembersoftheuniversitycommunityyouarerequiredtoabidebyt
The population variance of a finite population X of size N and mean µ is given by
Var(X) = 1
N
N
Â
i=1
(xi µ)
2.
(a) What is the population variance of the relative letter frequencies in English text?
(b) What is the population variance of the relative letter frequencies in the given plaintext?
(c) For each of the following keys — yz, xyz, wxyz, vwxyz, uvwxyz — encrypt the plaintext
with a Vigenère cipher and the given key, then calculate and report the population
variance of the relative letter frequencies in the resulting ciphertext. Describe and briefly
explain the trend in this sequence of variances.
(d) Viewing a Vigenère key of length k as a collection of k independent Caesar ciphers,
calculate the mean of the frequency variances of the ciphertext for each one. (E.g., for
key yz, calculate the frequency variance of the even numbered ciphertext characters
and the frequency variance of the odd numbered ciphertext characters. Then take their
mean.) Report the result for each key in part (c). Is the mean variance like those
observed in part (b)? Part (c)? Briefly explain.
(e) Consider the ciphertext that was produced with key uvwxyz. In part (d), you calculated
the mean of six variances for this key. Revisit that ciphertext, and calculate the mean of
the frequency variances that arise if you had assumed that the key had length 2, 3, 4, and
5. Does this suggest a variant to the Kasiski attack? (Don’t say no!) Briefly explain. ⇤
2
Submission Template
# Problem 1:
key=XXXXXXXXXX
show_your_work_here …
# Problem 2:
part_a_var_english=0.0000000
part_b_var_plaintext=0.0000000
part_c_var_ciphertexts=[0.0000000, 0.0000000, 0.0000000, 0.0000000, 0.0000000]
part_c_explain=”briefly_describe_and_explain_trend …”
part_d_means=[0.0000000, 0.0000000, 0.0000000, 0.0000000, 0.0000000]
part_d_explain=”briefly_compare_and_explain_results …”
part_e_means=[0.0000000, 0.0000000, 0.0000000, 0.0000000]
part_e_explain=”briefly_explain_attack_variant …”
show_your_work_here …
3

Open chat
Need help?
Hello
Can we help you?